SCOP 1.65: Domain d1vhp__: 1vhp -

Lineage for d1vhp__ (1vhp -)

1. Root: SCOP 1.65

2. Class b: All beta proteins [48724] (126 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (21 proteins)

6. Protein Immunoglobulin heavy chain variable domain, VH [88543] (19 species)
   VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogeneous CDRs are listed as engineered species

7. Species Engineered (including hybrid species) [88562] (24 PDB entries)

8. Domain d1vhp__: 1vhp - [20504]
   camelized monomeric VH

Details for d1vhp__

PDB Entry: 1vhp

PDB Description: vh-p8, nmr

SCOP Domain Sequences for d1vhp__:

Sequence; same for both SEQRES and ATOM records:

>d1vhp__ b.1.1.1 (-) Immunoglobulin heavy chain variable domain, VH {Engineered (including hybrid species)}
evqlvesggglvqpggslrlscaasgftfssyamswvrqapgkereivsavsgsggstyy
adsvkgrftisrdnskntlylqmnslraedtavyycarlkkyafdywgqgtlvtvss

Timeline for d1vhp__:

• d1vhp__ first appeared (with stable ids) in SCOP 1.55
  
• d1vhp__ appears in SCOP 1.63
  
• d1vhp__ appears in SCOP 1.67
  
• d1vhp__ appears in the current release, SCOPe 2.08, called d1vhpa_