Class b: All beta proteins [48724] (177 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
Protein Immunoglobulin light chain lambda variable domain, VL-lambda [88534] (9 species) VL-lambda domains of human antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the human genome; mouse VL-lambda domains belong to a single germline family |
Species Mouse (Mus musculus) [TaxId:10090] [88541] (35 PDB entries) |
Domain d1dl7l_: 1dl7 L: [20498] Other proteins in same PDB: d1dl7h_ part of Fv M3C65; conflict: annotated in PDB as human protein complexed with nch |
PDB Entry: 1dl7 (more details), 2.35 Å
SCOPe Domain Sequences for d1dl7l_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1dl7l_ b.1.1.1 (L:) Immunoglobulin light chain lambda variable domain, VL-lambda {Mouse (Mus musculus) [TaxId: 10090]} qavvtqesalttspgetvtltcrsstgavttsnyanwvqekpdhlftgliggtkhrtpga parfsgsligdkaaltitgaqtedeaiyfcalwysnhwvfgggtkltvl
Timeline for d1dl7l_: