Lineage for d1dl7l_ (1dl7 L:)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 6993Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 6994Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 6995Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (12 proteins)
  6. 7065Protein Immunoglobulin (variable domains of L and H chains) [48749] (183 species)
  7. 7910Species Fv M3C65, (human), lambda L chain [48910] (1 PDB entry)
  8. 7912Domain d1dl7l_: 1dl7 L: [20498]

Details for d1dl7l_

PDB Entry: 1dl7 (more details), 2.35 Å

PDB Description: the structural basis of repertoire shift in an immune response to phosphocholine

SCOP Domain Sequences for d1dl7l_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dl7l_ b.1.1.1 (L:) Immunoglobulin (variable domains of L and H chains) {Fv M3C65, (human), lambda L chain}
qavvtqesalttspgetvtltcrsstgavttsnyanwvqekpdhlftgliggtkhrtpga
parfsgsligdkaaltitgaqtedeaiyfcalwysnhwvfgggtkltvl

SCOP Domain Coordinates for d1dl7l_:

Click to download the PDB-style file with coordinates for d1dl7l_.
(The format of our PDB-style files is described here.)

Timeline for d1dl7l_: