![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.14: ClpP/crotonase [52095] (1 superfamily) core: 4 turns of (beta-beta-alpha)n superhelix |
![]() | Superfamily c.14.1: ClpP/crotonase [52096] (5 families) ![]() |
![]() | Family c.14.1.3: Crotonase-like [52103] (14 proteins) |
![]() | Protein automated matches [190669] (6 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [187771] (5 PDB entries) |
![]() | Domain d2hw5d_: 2hw5 D: [204639] automated match to d2duba_ complexed with coo, mg |
PDB Entry: 2hw5 (more details), 2.55 Å
SCOPe Domain Sequences for d2hw5d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2hw5d_ c.14.1.3 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]} anfeyiiaekrgknntvgliqlnrpkalnalcdglidelnqalkifeedpavgaivltgg dkafaagadikemqnlsfqdcysskflkhwdhltqvkkpviaavngyafgggcelammcd iiyagekaqfaqpeiligtipgaggtqrltravgkslamemvltgdrisaqdakqaglvs kicpvetlveeaiqcaekiasnskivvamakesvnaafemtltegsklekklfystfatd drkegmtafvekrkanfkdq
Timeline for d2hw5d_: