SCOPe 2.05: Domain d2egoa_: 2ego A:

Lineage for d2egoa_ (2ego A:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.36: PDZ domain-like [50155] (1 superfamily)
   contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix

4. Superfamily b.36.1: PDZ domain-like [50156] (7 families)
   peptide-binding domain

5. Family b.36.1.0: automated matches [191362] (1 protein)
   not a true family

6. Protein automated matches [190436] (6 species)
   not a true protein

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [187666] (10 PDB entries)

8. Domain d2egoa_: 2ego A: [204120]
   automated match to d2egna_

Details for d2egoa_

PDB Entry: 2ego, 1.8 Å

PDB Description: crystal structure of tamalin pdz domain

PDB Compounds: (A:) General receptor for phosphoinositides 1-associated scaffold protein

SCOPe Domain Sequences for d2egoa_:

Sequence, based on SEQRES records:

>d2egoa_ b.36.1.0 (A:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
sqqrkvltlekgdnqtfgfeiqtyglhhreeqrvemvtfvarvhesspaqlagltpgdti
asvnglnvegirhreivdiikasgnvlrletlygt

Sequence, based on observed residues (ATOM records):

>d2egoa_ b.36.1.0 (A:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
sqqrkvltlekgdnqtfgfeiqtyglvemvtfvarvhesspaqlagltpgdtiasvngln
vegirhreivdiikasgnvlrletlygt

Timeline for d2egoa_:

• d2egoa_ first appeared in SCOPe 2.03
  
• d2egoa_ appears in SCOPe 2.04
  
• d2egoa_ is called d2egoa1 in SCOPe 2.06
  
• d2egoa_ appears in the current release, SCOPe 2.08, called d2egoa1