Lineage for d2dhhc1 (2dhh C:1-37,C:331-498)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2633435Fold f.35: Multidrug efflux transporter AcrB transmembrane domain [82865] (1 superfamily)
    12 transmembrane helices; duplication: the N- and C-terminal halves of the whole proteins are structurally similar
  4. 2633436Superfamily f.35.1: Multidrug efflux transporter AcrB transmembrane domain [82866] (1 family) (S)
  5. 2633437Family f.35.1.1: Multidrug efflux transporter AcrB transmembrane domain [82867] (1 protein)
  6. 2633438Protein Multidrug efflux transporter AcrB transmembrane domain [82868] (1 species)
  7. 2633439Species Escherichia coli [TaxId:562] [82869] (7 PDB entries)
  8. 2633448Domain d2dhhc1: 2dhh C:1-37,C:331-498 [204009]
    Other proteins in same PDB: d2dhha2, d2dhha3, d2dhha4, d2dhha6, d2dhha7, d2dhha8, d2dhhb2, d2dhhb3, d2dhhb4, d2dhhb6, d2dhhb7, d2dhhb8, d2dhhc2, d2dhhc3, d2dhhc4, d2dhhc6, d2dhhc7, d2dhhc8
    automated match to d1iwga7

Details for d2dhhc1

PDB Entry: 2dhh (more details), 2.8 Å

PDB Description: Crystal structure of a multidrug transporter reveal a functionally rotating mechanism
PDB Compounds: (C:) AcrB

SCOPe Domain Sequences for d2dhhc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dhhc1 f.35.1.1 (C:1-37,C:331-498) Multidrug efflux transporter AcrB transmembrane domain {Escherichia coli [TaxId: 562]}
mpnffidrpifawviaiiimlagglailklpvaqyptXpfvkisihevvktlveaiilvf
lvmylflqnfratliptiavpvvllgtfavlaafgfsintltmfgmvlaigllvddaivv
venvervmaeeglppkeatrksmgqiqgalvgiamvlsavfvpmaffggstgaiyrqfsi
tivsamalsvlvaliltpalcatmlk

SCOPe Domain Coordinates for d2dhhc1:

Click to download the PDB-style file with coordinates for d2dhhc1.
(The format of our PDB-style files is described here.)

Timeline for d2dhhc1: