SCOPe 2.07: Domain d2dhhb4: 2dhh B:182-273

Lineage for d2dhhb4 (2dhh B:182-273)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.225: Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains [82713] (1 superfamily)
   Intertwined pseudo hexamer of an alpha+beta motif

4. Superfamily d.225.1: Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains [82714] (1 family)
   duplication: the N- and C-terminal halves of the whole proteins are structurally similar

5. Family d.225.1.1: Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains [82715] (1 protein)

6. Protein Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains [82716] (1 species)

7. Species Escherichia coli [TaxId:562] [82717] (7 PDB entries)

8. Domain d2dhhb4: 2dhh B:182-273 [204004]
   Other proteins in same PDB: d2dhha1, d2dhha2, d2dhha3, d2dhha5, d2dhha6, d2dhha7, d2dhhb1, d2dhhb2, d2dhhb3, d2dhhb5, d2dhhb6, d2dhhb7, d2dhhc1, d2dhhc2, d2dhhc3, d2dhhc5, d2dhhc6, d2dhhc7
   automated match to d1iwga5

Details for d2dhhb4

PDB Entry: 2dhh, 2.8 Å

PDB Description: Crystal structure of a multidrug transporter reveal a functionally rotating mechanism

PDB Compounds: (B:) AcrB

SCOPe Domain Sequences for d2dhhb4:

Sequence; same for both SEQRES and ATOM records:

>d2dhhb4 d.225.1.1 (B:182-273) Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains {Escherichia coli [TaxId: 562]}
yamriwmnpnelnkfqltpvdvitaikaqnaqvaagqlggtppvkgqqlnasiiaqtrlt
steefgkillkvnqdgsrvllrdvakielgge

Timeline for d2dhhb4:

• d2dhhb4 first appeared in SCOPe 2.03
  
• d2dhhb4 appears in SCOPe 2.06
  
• d2dhhb4 appears in the current release, SCOPe 2.08