Class f: Membrane and cell surface proteins and peptides [56835] (60 folds) |
Fold f.35: Multidrug efflux transporter AcrB transmembrane domain [82865] (1 superfamily) 12 transmembrane helices; duplication: the N- and C-terminal halves of the whole proteins are structurally similar |
Superfamily f.35.1: Multidrug efflux transporter AcrB transmembrane domain [82866] (1 family) |
Family f.35.1.1: Multidrug efflux transporter AcrB transmembrane domain [82867] (1 protein) |
Protein Multidrug efflux transporter AcrB transmembrane domain [82868] (1 species) |
Species Escherichia coli [TaxId:562] [82869] (7 PDB entries) |
Domain d2dhhb1: 2dhh B:1-37,B:331-498 [204001] Other proteins in same PDB: d2dhha2, d2dhha3, d2dhha4, d2dhha6, d2dhha7, d2dhha8, d2dhhb2, d2dhhb3, d2dhhb4, d2dhhb6, d2dhhb7, d2dhhb8, d2dhhc2, d2dhhc3, d2dhhc4, d2dhhc6, d2dhhc7, d2dhhc8 automated match to d1iwga7 |
PDB Entry: 2dhh (more details), 2.8 Å
SCOPe Domain Sequences for d2dhhb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2dhhb1 f.35.1.1 (B:1-37,B:331-498) Multidrug efflux transporter AcrB transmembrane domain {Escherichia coli [TaxId: 562]} mpnffidrpifawviaiiimlagglailklpvaqyptXpfvkisihevvktlveaiilvf lvmylflqnfratliptiavpvvllgtfavlaafgfsintltmfgmvlaigllvddaivv venvervmaeeglppkeatrksmgqiqgalvgiamvlsavfvpmaffggstgaiyrqfsi tivsamalsvlvaliltpalcatmlk
Timeline for d2dhhb1: