SCOPe 2.04: Domain d2ddac2: 2dda C:155-211

Lineage for d2ddac2 (2dda C:155-211)

1. Root: SCOPe 2.04

2. Class g: Small proteins [56992] (91 folds)

3. Fold g.19: Crisp domain-like [57545] (1 superfamily)
   disulfide-rich all-alpha fold

4. Superfamily g.19.1: Crisp domain-like [57546] (3 families)

5. Family g.19.1.0: automated matches [227153] (1 protein)
   not a true family

6. Protein automated matches [226858] (4 species)
   not a true protein

7. Species Pseudechis australis [TaxId:8670] [225218] (1 PDB entry)

8. Domain d2ddac2: 2dda C:155-211 [203958]
   Other proteins in same PDB: d2ddaa1, d2ddab1, d2ddac1, d2ddad1
   automated match to d1rc9a2
   complexed with fmt, gol, na

Details for d2ddac2

PDB Entry: 2dda, 2.25 Å

PDB Description: Crystal structure of pseudechetoxin from Pseudechis australis

PDB Compounds: (C:) Pseudechetoxin

SCOPe Domain Sequences for d2ddac2:

Sequence; same for both SEQRES and ATOM records:

>d2ddac2 g.19.1.0 (C:155-211) automated matches {Pseudechis australis [TaxId: 8670]}
ppcadcpsacvnklctnpckrnndfsnckslakkskcqtewikkkcpascfchnkii

Timeline for d2ddac2:

• d2ddac2 first appeared in SCOPe 2.03
  
• d2ddac2 appears in SCOPe 2.05
  
• d2ddac2 appears in the current release, SCOPe 2.08