PDB entry 2dda

View 2dda on RCSB PDB site
Description: Crystal structure of pseudechetoxin from Pseudechis australis
Class: toxin
Keywords: CRISP, snake venom, CNG channel, TOXIN
Deposited on 2006-01-25, released 2007-01-30
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: 0.203
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Pseudechetoxin
    Species: Pseudechis australis [TaxId:8670]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2ddaa1, d2ddaa2
  • Chain 'B':
    Compound: Pseudechetoxin
    Species: Pseudechis australis [TaxId:8670]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2ddab1, d2ddab2
  • Chain 'C':
    Compound: Pseudechetoxin
    Species: Pseudechis australis [TaxId:8670]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2ddac1, d2ddac2
  • Chain 'D':
    Compound: Pseudechetoxin
    Species: Pseudechis australis [TaxId:8670]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2ddad1, d2ddad2
  • Heterogens: NA, FMT, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2ddaA (A:)
    snkknyqkeivdkhnalrrsvkptarnmlqmkwnsraaqnakrwanrctfahsppnkrtv
    gklrcgenifmssqpfpwsgvvqawydeiknfvygigakppgsvighytqvvwyksylig
    casakcssskylyvcqycpagnirgsiatpyksgppcadcpsacvnklctnpckrnndfs
    nckslakkskcqtewikkkcpascfchnkii
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ddaA (A:)
    knyqkeivdkhnalrrsvkptarnmlqmkwnsraaqnakrwanrctfahsppnkrtvgkl
    rcgenifmssqpfpwsgvvqawydeiknfvygigakppgsvighytqvvwyksyligcas
    akcssskylyvcqycpagnirgsiatpyksgppcadcpsacvnklctnpckrnndfsnck
    slakkskcqtewikkkcpascfchnkii
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2ddaB (B:)
    snkknyqkeivdkhnalrrsvkptarnmlqmkwnsraaqnakrwanrctfahsppnkrtv
    gklrcgenifmssqpfpwsgvvqawydeiknfvygigakppgsvighytqvvwyksylig
    casakcssskylyvcqycpagnirgsiatpyksgppcadcpsacvnklctnpckrnndfs
    nckslakkskcqtewikkkcpascfchnkii
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ddaB (B:)
    knyqkeivdkhnalrrsvkptarnmlqmkwnsraaqnakrwanrctfahsppnkrtvgkl
    rcgenifmssqpfpwsgvvqawydeiknfvygigakppgsvighytqvvwyksyligcas
    akcssskylyvcqycpagnirgsiatpyksgppcadcpsacvnklctnpckrnndfsnck
    slakkskcqtewikkkcpascfchnkii
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2ddaC (C:)
    snkknyqkeivdkhnalrrsvkptarnmlqmkwnsraaqnakrwanrctfahsppnkrtv
    gklrcgenifmssqpfpwsgvvqawydeiknfvygigakppgsvighytqvvwyksylig
    casakcssskylyvcqycpagnirgsiatpyksgppcadcpsacvnklctnpckrnndfs
    nckslakkskcqtewikkkcpascfchnkii
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ddaC (C:)
    knyqkeivdkhnalrrsvkptarnmlqmkwnsraaqnakrwanrctfahsppnkrtvgkl
    rcgenifmssqpfpwsgvvqawydeiknfvygigakppgsvighytqvvwyksyligcas
    akcssskylyvcqycpagnirgsiatpyksgppcadcpsacvnklctnpckrnndfsnck
    slakkskcqtewikkkcpascfchnkii
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2ddaD (D:)
    snkknyqkeivdkhnalrrsvkptarnmlqmkwnsraaqnakrwanrctfahsppnkrtv
    gklrcgenifmssqpfpwsgvvqawydeiknfvygigakppgsvighytqvvwyksylig
    casakcssskylyvcqycpagnirgsiatpyksgppcadcpsacvnklctnpckrnndfs
    nckslakkskcqtewikkkcpascfchnkii
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ddaD (D:)
    knyqkeivdkhnalrrsvkptarnmlqmkwnsraaqnakrwanrctfahsppnkrtvgkl
    rcgenifmssqpfpwsgvvqawydeiknfvygigakppgsvighytqvvwyksyligcas
    akcssskylyvcqycpagnirgsiatpyksgppcadcpsacvnklctnpckrnndfsnck
    slakkskcqtewikkkcpascfchnkii