Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.111: PR-1-like [55796] (1 superfamily) alpha-beta-alpha-beta-alpha(2)-beta(2); 3 layers, alpha/beta/alpha; mixed sheet: order 1342 |
Superfamily d.111.1: PR-1-like [55797] (2 families) |
Family d.111.1.0: automated matches [227200] (1 protein) not a true family |
Protein automated matches [226929] (3 species) not a true protein |
Species Pseudechis australis [TaxId:8670] [225217] (1 PDB entry) |
Domain d2ddaa1: 2dda A:4-154 [203953] Other proteins in same PDB: d2ddaa2, d2ddab2, d2ddac2, d2ddad2 automated match to d1rc9a1 complexed with fmt, gol, na |
PDB Entry: 2dda (more details), 2.25 Å
SCOPe Domain Sequences for d2ddaa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ddaa1 d.111.1.0 (A:4-154) automated matches {Pseudechis australis [TaxId: 8670]} knyqkeivdkhnalrrsvkptarnmlqmkwnsraaqnakrwanrctfahsppnkrtvgkl rcgenifmssqpfpwsgvvqawydeiknfvygigakppgsvighytqvvwyksyligcas akcssskylyvcqycpagnirgsiatpyksg
Timeline for d2ddaa1: