Class g: Small proteins [56992] (98 folds) |
Fold g.19: Crisp domain-like [57545] (1 superfamily) disulfide-rich all-alpha fold |
Superfamily g.19.1: Crisp domain-like [57546] (3 families) |
Family g.19.1.0: automated matches [227153] (1 protein) not a true family |
Protein automated matches [226858] (5 species) not a true protein |
Species Pseudechis australis [TaxId:8670] [225218] (1 PDB entry) |
Domain d2ddab2: 2dda B:155-211 [203956] Other proteins in same PDB: d2ddaa1, d2ddab1, d2ddac1, d2ddad1 automated match to d1rc9a2 complexed with fmt, gol, na |
PDB Entry: 2dda (more details), 2.25 Å
SCOPe Domain Sequences for d2ddab2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ddab2 g.19.1.0 (B:155-211) automated matches {Pseudechis australis [TaxId: 8670]} ppcadcpsacvnklctnpckrnndfsnckslakkskcqtewikkkcpascfchnkii
Timeline for d2ddab2: