SCOPe 2.08: Domain d2ddab2: 2dda B:155-211

Lineage for d2ddab2 (2dda B:155-211)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.19: Crisp domain-like [57545] (1 superfamily)
   disulfide-rich all-alpha fold

4. Superfamily g.19.1: Crisp domain-like [57546] (3 families)

5. Family g.19.1.0: automated matches [227153] (1 protein)
   not a true family

6. Protein automated matches [226858] (5 species)
   not a true protein

7. Species Pseudechis australis [TaxId:8670] [225218] (1 PDB entry)

8. Domain d2ddab2: 2dda B:155-211 [203956]
   Other proteins in same PDB: d2ddaa1, d2ddab1, d2ddac1, d2ddad1
   automated match to d1rc9a2
   complexed with fmt, gol, na

Details for d2ddab2

PDB Entry: 2dda, 2.25 Å

PDB Description: Crystal structure of pseudechetoxin from Pseudechis australis

PDB Compounds: (B:) Pseudechetoxin

SCOPe Domain Sequences for d2ddab2:

Sequence; same for both SEQRES and ATOM records:

>d2ddab2 g.19.1.0 (B:155-211) automated matches {Pseudechis australis [TaxId: 8670]}
ppcadcpsacvnklctnpckrnndfsnckslakkskcqtewikkkcpascfchnkii

Timeline for d2ddab2:

• d2ddab2 first appeared in SCOPe 2.03
  
• d2ddab2 appears in SCOPe 2.07