Lineage for d1rc9a2 (1rc9 A:165-221)
- Root: SCOPe 2.07
Class g: Small proteins [56992] (98 folds) 
Fold g.19: Crisp domain-like [57545] (1 superfamily)
disulfide-rich all-alpha foldSuperfamily g.19.1: Crisp domain-like [57546] (3 families) 
Family g.19.1.2: Crisp domain [118259] (1 protein)
Pfam PF08562; contains extra N-terminal knottin-like subdomainProtein Cysteine-rich secretory protein (SteCRISP) [118260] (1 species) Species Chinese green tree viper (Trimeresurus stejnegeri) [TaxId:39682] [118261] (1 PDB entry)
Uniprot P60623 13-233
Domain d1rc9a2: 1rc9 A:165-221 [111766]
Other proteins in same PDB: d1rc9a1
Details for d1rc9a2
PDB Entry: 1rc9 (more details), 1.6 Å
PDB Description: crystal structure of stecrisp, a member of crisp family from trimeresurus stejnegeri refined at 1.6 angstroms resolution: structual relationship of the two domains
PDB Compounds: (A:) cysteine-rich secretory proteinSCOPe Domain Sequences for d1rc9a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rc9a2 g.19.1.2 (A:165-221) Cysteine-rich secretory protein (SteCRISP) {Chinese green tree viper (Trimeresurus stejnegeri) [TaxId: 39682]}
tpcgdcpsdcdnglctnpctrenkftncntmvqqsscqdnymktncpascfcqnkii
SCOPe Domain Coordinates for d1rc9a2:
Click to download the PDB-style file with coordinates for d1rc9a2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1rc9a2:
- d1rc9a2 first appeared in SCOP 1.71
- d1rc9a2 appears in SCOPe 2.06
- d1rc9a2 appears in the current release, SCOPe 2.08
View in 3D
