Lineage for d2cfhb_ (2cfh B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3009508Fold d.278: Ligand-binding domain in the NO signalling and Golgi transport [111125] (1 superfamily)
    an N-terminal helical bundle and the C-terminal alpha-beta(2)-alpha-beta(2) subdomain enclose a ligand-binding cavity
  4. 3009509Superfamily d.278.1: Ligand-binding domain in the NO signalling and Golgi transport [111126] (4 families) (S)
  5. 3009560Family d.278.1.2: TRAPP components [118076] (3 proteins)
    Pfam PF04051; form homo- and hetero-dimers with the first two helices of one subunit complementing the fold of the other subunit to the H-NOX domain fold
  6. 3009570Protein automated matches [190535] (2 species)
    not a true protein
  7. 3009571Species Human (Homo sapiens) [TaxId:9606] [187502] (4 PDB entries)
  8. 3009575Domain d2cfhb_: 2cfh B: [203783]
    automated match to d1wc8a_
    complexed with plm

Details for d2cfhb_

PDB Entry: 2cfh (more details), 2.3 Å

PDB Description: structure of the bet3-tpc6b core of trapp
PDB Compounds: (B:) Trafficking protein particle complex subunit 3

SCOPe Domain Sequences for d2cfhb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cfhb_ d.278.1.2 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sselftltygalvtqlckdyendedvnkqldkmgfnigvrliedflarsnvgrchdfret
adviakvafkmylgitpsitnwspagdefslilennplvdfvelpdnhssliysnllcgv
lrgalemvqmaveakfvqdtlkgdgvteirmrfirriednlp

SCOPe Domain Coordinates for d2cfhb_:

Click to download the PDB-style file with coordinates for d2cfhb_.
(The format of our PDB-style files is described here.)

Timeline for d2cfhb_: