Class b: All beta proteins [48724] (177 folds) |
Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.2: SH3-domain [50044] (2 families) |
Family b.34.2.1: SH3-domain [50045] (40 proteins) |
Protein Hemapoetic cell kinase Hck [50062] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [50063] (26 PDB entries) |
Domain d2c0tb1: 2c0t B:60-120 [203679] Other proteins in same PDB: d2c0ta2, d2c0ta3, d2c0ta4, d2c0tb2, d2c0tb3, d2c0tb4 automated match to d1qcfa1 complexed with ca, l3g |
PDB Entry: 2c0t (more details), 2.15 Å
SCOPe Domain Sequences for d2c0tb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2c0tb1 b.34.2.1 (B:60-120) Hemapoetic cell kinase Hck {Human (Homo sapiens) [TaxId: 9606]} iivvalydyeaihhedlsfqkgdqmvvleesgewwkarslatrkegyipsnyvarvdsle t
Timeline for d2c0tb1:
View in 3D Domains from other chains: (mouse over for more information) d2c0ta1, d2c0ta2, d2c0ta3, d2c0ta4 |