PDB entry 2c0t

View 2c0t on RCSB PDB site
Description: src family kinase hck with bound inhibitor a-641359
Class: transferase
Keywords: transferase, ATP-binding, kinase, lipoprotein, myristate, nucleotide-binding, palmitate, sh2 domain, sh3 domain
Deposited on 2005-09-07, released 2006-09-20
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-31.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: 0.197
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tyrosine-protein kinase HCK
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2C0T (Start-7)
      • engineered mutation (450-452)
    • Uniprot P08631 (8-453)
    Domains in SCOPe 2.06: d2c0ta1, d2c0ta2, d2c0ta3, d2c0ta4
  • Chain 'B':
    Compound: Tyrosine-protein kinase HCK
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2C0T (Start-7)
      • engineered mutation (450-452)
    • Uniprot P08631 (8-453)
    Domains in SCOPe 2.06: d2c0tb1, d2c0tb2, d2c0tb3, d2c0tb4
  • Heterogens: L3G, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2c0tA (A:)
    gamgsgiriivvalydyeaihhedlsfqkgdqmvvleesgewwkarslatrkegyipsny
    varvdsleteewffkgisrkdaerqllapgnmlgsfmirdsettkgsyslsvrdydprqg
    dtvkhykirtldnggfyisprstfstlqelvdhykkgndglcqklsvpcmsskpqkpwek
    daweipreslklekklgagqfgevwmatynkhtkvavktmkpgsmsveaflaeanvmktl
    qhdklvklhavvtkepiyiitefmakgslldflksdegskqplpklidfsaqiaegmafi
    eqrnyihrdlraanilvsaslvckiadfglarviedneytaregakfpikwtapeainfg
    sftiksdvwsfgillmeivtygripypgmsnpeviralergyrmprpencpeelynimmr
    cwknrpeerptfeyiqsvlddfytatesqyeeip
    

    Sequence, based on observed residues (ATOM records): (download)
    >2c0tA (A:)
    riivvalydyeaihhedlsfqkgdqmvvleesgewwkarslatrkegyipsnyvarvdsl
    eteewffkgisrkdaerqllapgnmlgsfmirdsettkgsyslsvrdydprqgdtvkhyk
    irfyisprstfstlqelvdhykkgndglcqklsvpcmsskpqkpwekdaweipreslkle
    kklgagqfgevwmatynkhtkvavktmkpgsmsveaflaeanvmktlqhdklvklhavvt
    kepiyiitefmakgslldflksdegskqplpklidfsaqiaegmafieqrnyihrdlraa
    nilvsaslvckiadfglarvipikwtapeainfgsftiksdvwsfgillmeivtygripy
    pgmsnpeviralergyrmprpencpeelynimmrcwknrpeerptfeyiqsvlddfytat
    esqyeeip
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2c0tB (B:)
    gamgsgiriivvalydyeaihhedlsfqkgdqmvvleesgewwkarslatrkegyipsny
    varvdsleteewffkgisrkdaerqllapgnmlgsfmirdsettkgsyslsvrdydprqg
    dtvkhykirtldnggfyisprstfstlqelvdhykkgndglcqklsvpcmsskpqkpwek
    daweipreslklekklgagqfgevwmatynkhtkvavktmkpgsmsveaflaeanvmktl
    qhdklvklhavvtkepiyiitefmakgslldflksdegskqplpklidfsaqiaegmafi
    eqrnyihrdlraanilvsaslvckiadfglarviedneytaregakfpikwtapeainfg
    sftiksdvwsfgillmeivtygripypgmsnpeviralergyrmprpencpeelynimmr
    cwknrpeerptfeyiqsvlddfytatesqyeeip
    

    Sequence, based on observed residues (ATOM records): (download)
    >2c0tB (B:)
    riivvalydyeaihhedlsfqkgdqmvvleesgewwkarslatrkegyipsnyvarvdsl
    eteewffkgisrkdaerqllapgnmlgsfmirdsettkgsyslsvrdydprqgdtvkhyk
    irtgfyisprstfstlqelvdhykkgndglcqklsvpcmsskpqkpwekdaweipreslk
    lekklgagqfgevwmatynkhtkvavktmkpgsmsveaflaeanvmktlqhdklvklhav
    vtkepiyiitefmakgslldflksdegskqplpklidfsaqiaegmafieqrnyihrdlr
    aanilvsaslvckiadfglarvipikwtapeainfgsftiksdvwsfgillmeivtygri
    pypgmsnpeviralergyrmprpencpeelynimmrcwknrpeerptfeyiqsvlddfyt
    atesqyeeip