Lineage for d2awpb2 (2awp B:84-196)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1903583Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily)
    alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213
  4. 1903584Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (2 families) (S)
    automatically mapped to Pfam PF02777
  5. 1903858Family d.44.1.0: automated matches [227155] (1 protein)
    not a true family
  6. 1903859Protein automated matches [226860] (30 species)
    not a true protein
  7. 1903949Species Malaria parasite (Plasmodium knowlesi) [TaxId:5850] [225015] (1 PDB entry)
  8. 1903951Domain d2awpb2: 2awp B:84-196 [203508]
    Other proteins in same PDB: d2awpa1, d2awpb1
    automated match to d1ma1a2
    complexed with cl, unx

Details for d2awpb2

PDB Entry: 2awp (more details), 2 Å

PDB Description: Crystal structure of Plasmodium knowlesi structure of Iron Super-Oxide Dismutase
PDB Compounds: (B:) Iron Super-Oxide Dismutase

SCOPe Domain Sequences for d2awpb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2awpb2 d.44.1.0 (B:84-196) automated matches {Malaria parasite (Plasmodium knowlesi) [TaxId: 5850]}
ncggephgeikekiqedfgsfnnfknefsnvlcghfgsgwgwlvlnnnnklvilqthdag
npikdntgipiltcdiwehayyidyrndrpsyvkawwnlvnwnfanenlkkal

SCOPe Domain Coordinates for d2awpb2:

Click to download the PDB-style file with coordinates for d2awpb2.
(The format of our PDB-style files is described here.)

Timeline for d2awpb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2awpb1