Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily) alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213 |
Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (2 families) automatically mapped to Pfam PF02777 |
Family d.44.1.0: automated matches [227155] (1 protein) not a true family |
Protein automated matches [226860] (25 species) not a true protein |
Species Malaria parasite (Plasmodium knowlesi) [TaxId:5850] [225015] (1 PDB entry) |
Domain d2awpb2: 2awp B:84-196 [203508] Other proteins in same PDB: d2awpa1, d2awpb1 automated match to d1ma1a2 complexed with cl, unx |
PDB Entry: 2awp (more details), 2 Å
SCOPe Domain Sequences for d2awpb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2awpb2 d.44.1.0 (B:84-196) automated matches {Malaria parasite (Plasmodium knowlesi) [TaxId: 5850]} ncggephgeikekiqedfgsfnnfknefsnvlcghfgsgwgwlvlnnnnklvilqthdag npikdntgipiltcdiwehayyidyrndrpsyvkawwnlvnwnfanenlkkal
Timeline for d2awpb2: