SCOPe 2.06: Domain d1yx2b1: 1yx2 B:1-282

Lineage for d1yx2b1 (1yx2 B:1-282)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.250: Folate-binding domain [103024] (1 superfamily)
   duplication: consists of two beta(2)-alpha-beta(3)-alpha subdomains swapped with the first strands

4. Superfamily d.250.1: Folate-binding domain [103025] (2 families)
   some topological similarity to Formylmethanofuran:tetrahydromethanopterin formyltransferase

5. Family d.250.1.1: Aminomethyltransferase folate-binding domain [103026] (4 proteins)

6. Protein Glycine cleavage system T protein, GcvT [111012] (4 species)

7. Species Bacillus subtilis [TaxId:1423] [224968] (1 PDB entry)

8. Domain d1yx2b1: 1yx2 B:1-282 [203236]
   Other proteins in same PDB: d1yx2a2, d1yx2b2
   automated match to d1v5va2
   complexed with edo

Details for d1yx2b1

PDB Entry: 1yx2, 2.08 Å

PDB Description: Crystal Structure of the Probable Aminomethyltransferase from Bacillus subtilis

PDB Compounds: (B:) Aminomethyltransferase

SCOPe Domain Sequences for d1yx2b1:

Sequence; same for both SEQRES and ATOM records:

>d1yx2b1 d.250.1.1 (B:1-282) Glycine cleavage system T protein, GcvT {Bacillus subtilis [TaxId: 1423]}
mlkrtplfdlykeyggktidfggwelpvqfssikkeheavrtaaglfdvshmgevevsgn
dslsflqrlmtndvsaltpgraqytamcypdggtvddlliyqkgenryllvinasnidkd
lawmkehaagdvqidnqsdqiallavqgpkaeailknltdadvsalkpfafideadisgr
kalisrtgytgedgyeiycrsddamhiwkkiidagdayglipcglgardtlrfeaniply
gqeltrditpieagigfavkhkkesdffgksvlseqkengak

Timeline for d1yx2b1:

• d1yx2b1 first appeared in SCOPe 2.03
  
• d1yx2b1 appears in SCOPe 2.05
  
• d1yx2b1 appears in SCOPe 2.07
  
• d1yx2b1 appears in the current release, SCOPe 2.08