Lineage for d1yi8c_ (1yi8 C:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2118897Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 2118898Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) (S)
  5. 2119569Family c.26.1.0: automated matches [191377] (1 protein)
    not a true family
  6. 2119570Protein automated matches [190459] (50 species)
    not a true protein
  7. 2119643Species Deinococcus radiodurans [TaxId:243230] [224963] (1 PDB entry)
  8. 2119646Domain d1yi8c_: 1yi8 C: [203194]
    automated match to d2g36a_
    protein/RNA complex; complexed with trp

Details for d1yi8c_

PDB Entry: 1yi8 (more details), 2.1 Å

PDB Description: Crystal structure of tryptophanyl trRNA synthetase II from Deinococcus radiodurans in complex with L-Trp
PDB Compounds: (C:) Tryptophanyl-tRNA synthetase

SCOPe Domain Sequences for d1yi8c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yi8c_ c.26.1.0 (C:) automated matches {Deinococcus radiodurans [TaxId: 243230]}
arprvltgdrptgalhlghlagslqnrvrlqdeaelfvlladvqaltdhfdrpeqvrenv
lavaldylaagldpqkttcvvqsavpelaeltvyflnlvtvshlrqnptvkaeiaqkgyg
ervpagffvypvsqaadiaafgatlvpvgddqlpmleqtreivrrfnalyapvlaepqaq
lsrvprlpgldgqakmskslgnaialgdsadevarkvmgmytdpghlrasdpgrvegnpv
ftfldafdpdparvqalkdqyragglgdvkvkkhlidvlngvlapirtrraeyerdpdav
lrfvtegtargrevaaqtlgqvrramrlfgh

SCOPe Domain Coordinates for d1yi8c_:

Click to download the PDB-style file with coordinates for d1yi8c_.
(The format of our PDB-style files is described here.)

Timeline for d1yi8c_: