SCOPe 2.08: Domain d1wk8b_: 1wk8 B:

Lineage for d1wk8b_ (1wk8 B:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.51: ValRS/IleRS/LeuRS editing domain [50676] (1 superfamily)
   core: barrel, closed; n=6, S=8; topology is similar to that of the acid proteases barrel

4. Superfamily b.51.1: ValRS/IleRS/LeuRS editing domain [50677] (1 family)

5. Family b.51.1.1: ValRS/IleRS/LeuRS editing domain [50678] (4 proteins)
   inserted into the catalytic domain

6. Protein Isoleucyl-tRNA synthetase (IleRS) [50679] (2 species)

7. Species Thermus thermophilus [TaxId:274] [50680] (6 PDB entries)

8. Domain d1wk8b_: 1wk8 B: [202992]
   automated match to d1ue0a_
   protein/RNA complex; complexed with vms

Details for d1wk8b_

PDB Entry: 1wk8, 1.7 Å

PDB Description: Isoleucyl-tRNA synthetase editing domain complexed with the pre-transfer editing substrate analogue, Val-AMS

PDB Compounds: (B:) isoleucyl-tRNA synthetase

SCOPe Domain Sequences for d1wk8b_:

Sequence; same for both SEQRES and ATOM records:

>d1wk8b_ b.51.1.1 (B:) Isoleucyl-tRNA synthetase (IleRS) {Thermus thermophilus [TaxId: 274]}
dpsvyvrfplkepkklglekaslliwtttpwtlpgnvaaavhpeytyaafqvgdealile
eglgrkllgegtpvlktfpgkaleglpytppypqalekgyfvvladyvsqedgtgivhqa
pafgaedletarvyglpllktvdeegkllvepfkglyfreanrailrdlrgrgllfkees
ylhsyph

Timeline for d1wk8b_:

• d1wk8b_ first appeared in SCOPe 2.03
  
• d1wk8b_ appears in SCOPe 2.07