SCOPe 2.08: Domain d4hv8c1: 4hv8 C:1-181

Lineage for d4hv8c1 (4hv8 C:1-181)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)

6. Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (29 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [226600] (3 PDB entries)

8. Domain d4hv8c1: 4hv8 C:1-181 [202489]
   Other proteins in same PDB: d4hv8a2, d4hv8b1, d4hv8b2, d4hv8c2, d4hv8d_
   automated match to d1kjva2
   complexed with so4

Details for d4hv8c1

PDB Entry: 4hv8, 2 Å

PDB Description: crystal structure of h2db-h155a-npm6i

PDB Compounds: (C:) H-2 class I histocompatibility antigen, D-B alpha chain

SCOPe Domain Sequences for d4hv8c1:

Sequence; same for both SEQRES and ATOM records:

>d4hv8c1 d.19.1.1 (C:1-181) Class I MHC, alpha-1 and alpha-2 domains {Mouse (Mus musculus) [TaxId: 10090]}
gphsmryfetavsrpgleepryisvgyvdnkefvrfdsdaenpryeprapwmeqegpeyw
eretqkakgqeqwfrvslrnllgyynqsaggshtlqqmsgcdlgsdwrllrgylqfayeg
rdyialnedlktwtaadmaaqitrrkweqsgaaeaykaylegecvewlhrylkngnatll
r

Timeline for d4hv8c1:

• d4hv8c1 first appeared in SCOPe 2.03
  
• d4hv8c1 appears in SCOPe 2.07