Class b: All beta proteins [48724] (180 folds) |
Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies) consists of six 4-stranded beta-sheet motifs; meander |
Superfamily b.68.1: Sialidases [50939] (3 families) |
Family b.68.1.0: automated matches [191452] (1 protein) not a true family |
Protein automated matches [190692] (20 species) not a true protein |
Species Influenza A virus, different strains [TaxId:11320] [188445] (32 PDB entries) |
Domain d4gezd_: 4gez D: [202252] automated match to d4gezk_ complexed with ca, fuc, nag |
PDB Entry: 4gez (more details), 2.5 Å
SCOPe Domain Sequences for d4gezd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4gezd_ b.68.1.0 (D:) automated matches {Influenza A virus, different strains [TaxId: 11320]} ywraksqmcevkgwvpthrgfpwgpelpgdlilsrrayvscdltscfkffiayglsanqh llntsmeweeslyktpigsastlstsemilpgrsssacfdglkwtvlvangrdrnsfimi kygeevtdtfsasrggplrlpnseciciegscfvivsdgpnvnqsvhriyelqngtvqrw kqlnttginfeystcytinnlikctgtnlwndakrpllrftkelnyqivepcngaptdfp rgglttpsckmaqekgeggiqgfildekpawtsktkaessqngfvleqipngiesegtvs lsyelfsnkrtgrsgffqpkgdlisgcqricfwleiedqtvglgmiqelstfcginspvq ninwd
Timeline for d4gezd_: