Lineage for d4fkya_ (4fky A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2951070Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (2 families) (S)
  5. 2951611Family d.58.6.0: automated matches [191597] (1 protein)
    not a true family
  6. 2951612Protein automated matches [191087] (19 species)
    not a true protein
  7. 2951834Species Trypanosoma brucei [TaxId:999953] [195043] (4 PDB entries)
  8. 2951838Domain d4fkya_: 4fky A: [202042]
    automated match to d4fkyc_
    complexed with gdp, mg, mpd

Details for d4fkya_

PDB Entry: 4fky (more details), 1.95 Å

PDB Description: Crystal structure of nucleoside diphosphate kinase B from Trypanosoma brucei bound to GTP
PDB Compounds: (A:) Nucleoside diphosphate kinase

SCOPe Domain Sequences for d4fkya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4fkya_ d.58.6.0 (A:) automated matches {Trypanosoma brucei [TaxId: 999953]}
mpsertfiavkpdgvqrnlvgeiikrfenkgyklvglkllqpteeqakqhyidlaskpfy
sglvsyfssgpivgmvweglgvvkggrvllgatnpadslpgtirgdfavdvgrnvchgsd
svesakreiafwfkaeelvswtshsvkqiyer

SCOPe Domain Coordinates for d4fkya_:

Click to download the PDB-style file with coordinates for d4fkya_.
(The format of our PDB-style files is described here.)

Timeline for d4fkya_: