Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.20: UBC-like [54494] (1 superfamily) alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2 |
Superfamily d.20.1: UBC-like [54495] (5 families) |
Family d.20.1.1: UBC-related [54496] (7 proteins) |
Protein Ubiquitin conjugating enzyme, UBC [54497] (33 species) |
Species Human (Homo sapiens), ubc13 [TaxId:9606] [64240] (5 PDB entries) |
Domain d4dhjc_: 4dhj C: [201702] Other proteins in same PDB: d4dhja_, d4dhjb_, d4dhjd_, d4dhje_, d4dhjf_, d4dhjh_, d4dhji_, d4dhjj_, d4dhjl_, d4dhjm_ automated match to d1j7db_ |
PDB Entry: 4dhj (more details), 2.35 Å
SCOPe Domain Sequences for d4dhjc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4dhjc_ d.20.1.1 (C:) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubc13 [TaxId: 9606]} glprriiketqrllaepvpgikaepdesnaryfhvviagpqdspfeggtfklelflpeey pmaapkvrfmtkiyhpnvdklgricldilkdkwspalqirtvllsiqallsapnpddpla ndvaeqwktneaqaietarawtrlyamnn
Timeline for d4dhjc_: