Lineage for d4a25c_ (4a25 C:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1727563Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 1727564Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 1729675Family a.25.1.0: automated matches [191307] (1 protein)
    not a true family
  6. 1729676Protein automated matches [190036] (33 species)
    not a true protein
  7. 1729764Species Kineococcus radiotolerans [TaxId:131568] [197069] (1 PDB entry)
  8. 1729767Domain d4a25c_: 4a25 C: [201397]
    automated match to d4a25a_
    complexed with cl, mn

Details for d4a25c_

PDB Entry: 4a25 (more details), 2 Å

PDB Description: X-ray structure Dps from Kineococcus radiotolerans in complex with Mn (II) ions.
PDB Compounds: (C:) ferritin dps family protein

SCOPe Domain Sequences for d4a25c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4a25c_ a.25.1.0 (C:) automated matches {Kineococcus radiotolerans [TaxId: 131568]}
ttihdvqttgltqdavtgfdassrlnaglqevlvdltalhlqgkqahwnivgenwrdlhl
qldtlveaargfsddvaermravggvpdarpqtvaasrigdvgpdeidtracveaivalv
rhtvdtirrvhdpidaedpasadllhaitlelekqawmigsenrsprrr

SCOPe Domain Coordinates for d4a25c_:

Click to download the PDB-style file with coordinates for d4a25c_.
(The format of our PDB-style files is described here.)

Timeline for d4a25c_: