SCOPe 2.03: Domain d4a25c_: 4a25 C:

Lineage for d4a25c_ (4a25 C:)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.25: Ferritin-like [47239] (6 superfamilies)
   core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection

4. Superfamily a.25.1: Ferritin-like [47240] (10 families)
   contains bimetal-ion centre in the middle of the bundle

5. Family a.25.1.0: automated matches [191307] (1 protein)
   not a true family

6. Protein automated matches [190036] (19 species)
   not a true protein

7. Species Kineococcus radiotolerans [TaxId:131568] [197069] (1 PDB entry)

8. Domain d4a25c_: 4a25 C: [201397]
   automated match to d4a25a_
   complexed with cl, mn

Details for d4a25c_

PDB Entry: 4a25, 2 Å

PDB Description: X-ray structure Dps from Kineococcus radiotolerans in complex with Mn (II) ions.

PDB Compounds: (C:) ferritin dps family protein

SCOPe Domain Sequences for d4a25c_:

Sequence; same for both SEQRES and ATOM records:

>d4a25c_ a.25.1.0 (C:) automated matches {Kineococcus radiotolerans [TaxId: 131568]}
ttihdvqttgltqdavtgfdassrlnaglqevlvdltalhlqgkqahwnivgenwrdlhl
qldtlveaargfsddvaermravggvpdarpqtvaasrigdvgpdeidtracveaivalv
rhtvdtirrvhdpidaedpasadllhaitlelekqawmigsenrsprrr

Timeline for d4a25c_:

• d4a25c_ is new in SCOPe 2.03-stable
  
• d4a25c_ appears in SCOPe 2.04
  
• d4a25c_ appears in the current release, SCOPe 2.08