SCOPe 2.07: Domain d3unbq_: 3unb q:

Lineage for d3unbq_ (3unb q:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
   4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing

4. Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families)
   N-terminal residue provides two catalytic groups, nucleophile and proton donor

5. Family d.153.1.4: Proteasome subunits [56251] (4 proteins)

6. Protein automated matches [190144] (14 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [195917] (3 PDB entries)

8. Domain d3unbq_: 3unb q: [201049]
   Other proteins in same PDB: d3unbe_, d3unbg_, d3unbs_, d3unbu_
   automated match to d3unbc_
   complexed with 04c

Details for d3unbq_

PDB Entry: 3unb, 2.9 Å

PDB Description: Mouse constitutive 20S proteasome in complex with PR-957

PDB Compounds: (q:) Proteasome subunit alpha type-2

SCOPe Domain Sequences for d3unbq_:

Sequence; same for both SEQRES and ATOM records:

>d3unbq_ d.153.1.4 (q:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
akrgysfslttfspsgklvqieyalaavaggapsvgikaangvvlatekkqksilyders
vhkvepitkhiglvysgmgpdyrvlvhrarklaqqyylvyqepiptaqlvqrvasvmqey
tqsggvrpfgvsllicgwnegrpylfqsdpsgayfawkatamgknyvngktflekryned
leledaihtailtlkesfegqmtednievgicneagfrrltptevrdylaa

Timeline for d3unbq_:

• d3unbq_ first appeared in SCOPe 2.03
  
• d3unbq_ appears in SCOPe 2.06
  
• d3unbq_ appears in the current release, SCOPe 2.08