SCOPe 2.07: Domain d3unby_: 3unb Y:

Lineage for d3unby_ (3unb Y:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
   4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing

4. Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families)
   N-terminal residue provides two catalytic groups, nucleophile and proton donor

5. Family d.153.1.4: Proteasome subunits [56251] (4 proteins)

6. Protein automated matches [190144] (14 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [195917] (3 PDB entries)

8. Domain d3unby_: 3unb Y: [195922]
   Other proteins in same PDB: d3unbe_, d3unbg_, d3unbs_, d3unbu_
   automated match to d1irul_
   complexed with 04c

Details for d3unby_

PDB Entry: 3unb, 2.9 Å

PDB Description: Mouse constitutive 20S proteasome in complex with PR-957

PDB Compounds: (Y:) Proteasome subunit beta type-5

SCOPe Domain Sequences for d3unby_:

Sequence; same for both SEQRES and ATOM records:

>d3unby_ d.153.1.4 (Y:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
tttlafkflhgvivaadsratagayiasqtvkkvieinpyllgtmaggaadcsfwerlla
rqcriyelrnkerisvaaaskllanmvyqykgmglsmgtmicgwdkrgpglyyvdsegnr
isgtafsvgsgsvyaygvmdrgysydlkveeaydlarraiyqatyrdaysggavnlyhvr
edgwirvssdnvadlhdkyss

Timeline for d3unby_:

• d3unby_ first appeared in SCOPe 2.02
  
• d3unby_ appears in SCOPe 2.06
  
• d3unby_ appears in the current release, SCOPe 2.08