Lineage for d3unbg_ (3unb G:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2594580Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2594581Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2594772Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 2594884Protein Proteasome alpha subunit (non-catalytic) [56255] (10 species)
    contains an extension to the common fold at the N-terminus
  7. 2597114Species Mouse (Mus musculus) [TaxId:10090] [195927] (2 PDB entries)
  8. 2597117Domain d3unbg_: 3unb G: [201040]
    Other proteins in same PDB: d3unb1_, d3unb2_, d3unb3_, d3unb4_, d3unba_, d3unbb_, d3unbc_, d3unbd_, d3unbe_, d3unbf_, d3unbh_, d3unbi_, d3unbj_, d3unbk_, d3unbl_, d3unbm_, d3unbn_, d3unbo_, d3unbp_, d3unbq_, d3unbr_, d3unbs_, d3unbt_, d3unbv_, d3unbw_, d3unbx_, d3unby_, d3unbz_
    automated match to d3unbu_
    complexed with 04c

Details for d3unbg_

PDB Entry: 3unb (more details), 2.9 Å

PDB Description: Mouse constitutive 20S proteasome in complex with PR-957
PDB Compounds: (G:) Proteasome subunit alpha type-6

SCOPe Domain Sequences for d3unbg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3unbg_ d.153.1.4 (G:) Proteasome alpha subunit (non-catalytic) {Mouse (Mus musculus) [TaxId: 10090]}
srgssagfdrhitifspegrlyqveyafkainqggltsvavrgkdcavivtqkkvpdkll
dsstvthlfkitesigcvmtgmtadsrsqvqraryeaanwkykygyeipvdmlckriadi
sqvytqnaemrplgccmiligideeqgpqvykcdpagyycgfkataagvkqtestsflek
kvkkkfdwtfeqtvetaitclstvlsidfkpseievgvvtvenpkfrilteaeidahlva
lae

SCOPe Domain Coordinates for d3unbg_:

Click to download the PDB-style file with coordinates for d3unbg_.
(The format of our PDB-style files is described here.)

Timeline for d3unbg_: