Lineage for d1yuhl1 (1yuh L:2-109)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1103261Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1103262Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1103263Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 1105202Protein Immunoglobulin light chain lambda variable domain, VL-lambda [88534] (9 species)
    VL-lambda domains of human antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the human genome; mouse VL-lambda domains belong to a single germline family
  7. 1105296Species Mouse (Mus musculus) [TaxId:10090] [88541] (34 PDB entries)
  8. 1105340Domain d1yuhl1: 1yuh L:2-109 [20096]
    Other proteins in same PDB: d1yuha2, d1yuhb1, d1yuhb2, d1yuhh1, d1yuhh2, d1yuhl2
    part of an anti-nitrophenol Fab
    complexed with np

Details for d1yuhl1

PDB Entry: 1yuh (more details), 3 Å

PDB Description: fab fragment
PDB Compounds: (L:) 88c6/12 fab (light chain)

SCOPe Domain Sequences for d1yuhl1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yuhl1 b.1.1.1 (L:2-109) Immunoglobulin light chain lambda variable domain, VL-lambda {Mouse (Mus musculus) [TaxId: 10090]}
avvtqesalttspgetvtltcrsstgavttsnyanwvqekpdrlftgliggtnnrgpgvp
arfsgsligdkaaltitgaqtedeaiyfcalwysnhwvfgggtkltvl

SCOPe Domain Coordinates for d1yuhl1:

Click to download the PDB-style file with coordinates for d1yuhl1.
(The format of our PDB-style files is described here.)

Timeline for d1yuhl1: