SCOP 1.55: Domain d1yuhl1: 1yuh L:2-109

Lineage for d1yuhl1 (1yuh L:2-109)

1. Root: SCOP 1.55

2. Class b: All beta proteins [48724] (93 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (12 proteins)

6. Protein Immunoglobulin (variable domains of L and H chains) [48749] (183 species)

7. Species Fab anti-nitrophenol (mouse), lambda L chain [48813] (1 PDB entry)

8. Domain d1yuhl1: 1yuh L:2-109 [20096]
   Other proteins in same PDB: d1yuha2, d1yuhb2, d1yuhh2, d1yuhl2

Details for d1yuhl1

PDB Entry: 1yuh, 3 Å

PDB Description: fab fragment

SCOP Domain Sequences for d1yuhl1:

Sequence; same for both SEQRES and ATOM records:

>d1yuhl1 b.1.1.1 (L:2-109) Immunoglobulin (variable domains of L and H chains) {Fab anti-nitrophenol (mouse), lambda L chain}
avvtqesalttspgetvtltcrsstgavttsnyanwvqekpdrlftgliggtnnrgpgvp
arfsgsligdkaaltitgaqtedeaiyfcalwysnhwvfgggtkltvl

Timeline for d1yuhl1:

• d1yuhl1 appears in SCOP 1.57
  
• d1yuhl1 appears in the current release, SCOPe 2.08