SCOPe 2.06: Domain d3sgya_: 3sgy A:

Lineage for d3sgya_ (3sgy A:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest

4. Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families)

5. Family c.71.1.1: Dihydrofolate reductases [53598] (4 proteins)

6. Protein automated matches [190514] (11 species)
   not a true protein

7. Species Staphylococcus aureus [TaxId:1280] [195885] (5 PDB entries)

8. Domain d3sgya_: 3sgy A: [200656]
   automated match to d3sgyb_
   complexed with 06w, ndp

Details for d3sgya_

PDB Entry: 3sgy, 2.6 Å

PDB Description: staphylococcus aureus dihydrofolate reductase complexed with nadph and 6-ethyl-5-[(3s)-3-[3-methoxy-5-(pyridin-4-yl)phenyl]but-1-yn-1-yl]pyrimidine-2,4-diamine (ucp1006)

PDB Compounds: (A:) dihydrofolate reductase

SCOPe Domain Sequences for d3sgya_:

Sequence; same for both SEQRES and ATOM records:

>d3sgya_ c.71.1.1 (A:) automated matches {Staphylococcus aureus [TaxId: 1280]}
tlsilvahdlqrvigfenqlpwhlpndlkhvkklstghtlvmgrktfesigkplpnrrnv
vltsdtsfnvegvdvihsiediyqlpghvfifggqtlfeemidkvddmyitviegkfrgd
tffppytfedwevassvegkldekntiphtflhlirk

Timeline for d3sgya_:

• d3sgya_ first appeared in SCOPe 2.03
  
• d3sgya_ appears in SCOPe 2.05
  
• d3sgya_ appears in SCOPe 2.07
  
• d3sgya_ appears in the current release, SCOPe 2.08