Lineage for d1knoc1 (1kno C:1-108)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 6993Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 6994Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 6995Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (12 proteins)
  6. 7065Protein Immunoglobulin (variable domains of L and H chains) [48749] (183 species)
  7. 7552Species Fab CNJ206 (mouse), kappa L chain [48792] (2 PDB entries)
  8. 7571Domain d1knoc1: 1kno C:1-108 [20010]
    Other proteins in same PDB: d1knoa2, d1knob2, d1knoc2, d1knod2, d1knoe2, d1knof2

Details for d1knoc1

PDB Entry: 1kno (more details), 3.2 Å

PDB Description: crystal structure of the complex of a catalytic antibody fab with a transition state analog: structural similarities in esterase-like abzymes

SCOP Domain Sequences for d1knoc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1knoc1 b.1.1.1 (C:1-108) Immunoglobulin (variable domains of L and H chains) {Fab CNJ206 (mouse), kappa L chain}
qiqmtqspsslsaslgervsltcrasqeisgylswlqqkpdgtikrliyaastldsgvpk
rfsgsrsgsdysltisslesedfadyyclqyasspytfgggtkleilr

SCOP Domain Coordinates for d1knoc1:

Click to download the PDB-style file with coordinates for d1knoc1.
(The format of our PDB-style files is described here.)

Timeline for d1knoc1: