Lineage for d1knof2 (1kno F:120-235)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 6993Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 6994Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 8163Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 8462Protein Immunoglobulin (constant domains of L and H chains) [48972] (152 species)
  7. 8860Species Fab CNJ206 (mouse), kappa L chain [49012] (2 PDB entries)
  8. 8882Domain d1knof2: 1kno F:120-235 [21067]
    Other proteins in same PDB: d1knoa1, d1knob1, d1knoc1, d1knod1, d1knoe1, d1knof1

Details for d1knof2

PDB Entry: 1kno (more details), 3.2 Å

PDB Description: crystal structure of the complex of a catalytic antibody fab with a transition state analog: structural similarities in esterase-like abzymes

SCOP Domain Sequences for d1knof2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1knof2 b.1.1.2 (F:120-235) Immunoglobulin (constant domains of L and H chains) {Fab CNJ206 (mouse), kappa L chain}
akttapsvyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsd
lytlsssvtvtsstwpsqsitcnvahpasstkvdkkieprg

SCOP Domain Coordinates for d1knof2:

Click to download the PDB-style file with coordinates for d1knof2.
(The format of our PDB-style files is described here.)

Timeline for d1knof2: