| Class b: All beta proteins [48724] (93 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (12 proteins) |
| Protein Immunoglobulin (variable domains of L and H chains) [48749] (183 species) |
| Species Fab CNJ206 (mouse), kappa L chain [48792] (2 PDB entries) |
| Domain d1knod1: 1kno D:1-119 [20011] Other proteins in same PDB: d1knoa2, d1knob2, d1knoc2, d1knod2, d1knoe2, d1knof2 |
PDB Entry: 1kno (more details), 3.2 Å
SCOP Domain Sequences for d1knod1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1knod1 b.1.1.1 (D:1-119) Immunoglobulin (variable domains of L and H chains) {Fab CNJ206 (mouse), kappa L chain}
dvklvesggglvqpggsrklscaasgftfssfgmhwvrqapekglewvayissgsstiyy
adtvkgrftisrdnpkntlflqmtslrsedtamyycargdyygsrgaywgqgtlvtvsa
Timeline for d1knod1: