SCOP 1.67: Domain d3hfll1: 3hfl L:1-106

Lineage for d3hfll1 (3hfl L:1-106)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (24 proteins)

6. Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (14 species)
   VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 3.2 [TaxId:10090] [88528] (18 PDB entries)

8. Domain d3hfll1: 3hfl L:1-106 [19968]
   Other proteins in same PDB: d3hflh1, d3hflh2, d3hfll2, d3hfly_
   part of Fab HyHEL-5

Details for d3hfll1

PDB Entry: 3hfl, 2.65 Å

PDB Description: the refined structure of the monoclonal antibody hy(slash)hel-5 with its antigen hen egg white lysozyme

SCOP Domain Sequences for d3hfll1:

Sequence; same for both SEQRES and ATOM records:

>d3hfll1 b.1.1.1 (L:1-106) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 3.2}
divltqspaimsaspgekvtmtcsasssvnymywyqqksgtspkrwiydtsklasgvpvr
fsgsgsgtsysltissmetedaatyycqqwgrnptfgggtklei

Timeline for d3hfll1:

• d3hfll1 first appeared (with stable ids) in SCOP 1.55
  
• d3hfll1 appears in SCOP 1.65
  
• d3hfll1 appears in SCOP 1.69
  
• d3hfll1 last appears in SCOP 1.71