Lineage for d3kqgd1 (3kqg D:199-326)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1940569Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 1940570Superfamily d.169.1: C-type lectin-like [56436] (9 families) (S)
  5. 1941287Family d.169.1.0: automated matches [191331] (1 protein)
    not a true family
  6. 1941288Protein automated matches [190159] (13 species)
    not a true protein
  7. 1941334Species Human (Homo sapiens) [TaxId:9606] [186882] (65 PDB entries)
  8. 1941483Domain d3kqgd1: 3kqg D:199-326 [199667]
    Other proteins in same PDB: d3kqga2, d3kqgb2, d3kqgc2, d3kqgd2, d3kqge2, d3kqgf2
    complexed with ca

Details for d3kqgd1

PDB Entry: 3kqg (more details), 2.3 Å

PDB Description: trimeric structure of langerin
PDB Compounds: (D:) C-type lectin domain family 4 member K

SCOPe Domain Sequences for d3kqgd1:

Sequence, based on SEQRES records: (download)

>d3kqgd1 d.169.1.0 (D:199-326) automated matches {Human (Homo sapiens) [TaxId: 9606]}
wkyfkgnfyyfslipktwysaeqfcvsrnshltsvtseseqeflyktaggliywigltka
gmegdwswvddtpfnkvqsarfwipgepnnagnnehcgnikapslqawndapcdktflfi
ckrpyvps

Sequence, based on observed residues (ATOM records): (download)

>d3kqgd1 d.169.1.0 (D:199-326) automated matches {Human (Homo sapiens) [TaxId: 9606]}
wkyfkgnfyyfslipktwysaeqfcvsrnshltsvtseseqeflyktaggliywigltka
gdwswvddtpfnkvqsarfwipgepnnagnnehcgnikapslqawndapcdktflfickr
pyvps

SCOPe Domain Coordinates for d3kqgd1:

Click to download the PDB-style file with coordinates for d3kqgd1.
(The format of our PDB-style files is described here.)

Timeline for d3kqgd1: