Lineage for d3b1rf_ (3b1r F:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2904325Fold c.72: Ribokinase-like [53612] (3 superfamilies)
    core: 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 21345678, strand 7 is antiparallel to the rest
    potential superfamily: members of this fold have similar functions but different ATP-binding sites
  4. 2904326Superfamily c.72.1: Ribokinase-like [53613] (6 families) (S)
    has extra strand located between strands 2 and 3
  5. 2904617Family c.72.1.0: automated matches [191321] (1 protein)
    not a true family
  6. 2904618Protein automated matches [190117] (50 species)
    not a true protein
  7. 2904644Species Burkholderia thailandensis [TaxId:271848] [196112] (5 PDB entries)
  8. 2904659Domain d3b1rf_: 3b1r F: [199008]
    automated match to d3b1rc_
    complexed with amp, mg

Details for d3b1rf_

PDB Entry: 3b1r (more details), 2 Å

PDB Description: Structure of Burkholderia thailandensis nucleoside kinase (BthNK) in complex with AMP-Mg-AMP
PDB Compounds: (F:) Ribokinase, putative

SCOPe Domain Sequences for d3b1rf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3b1rf_ c.72.1.0 (F:) automated matches {Burkholderia thailandensis [TaxId: 271848]}
atlicgsiaydnimtfegrfrehilpdqvhlinlsflvptmrrefggcagniayalnllg
gdarmmgtlgavdaqpyldrmdalglsreyvrvlpdtysaqamittdldnnqitafhpga
mmqshvnhageakdiklaivgpdgfqgmvqhteelaqagvpfifdpgqglplfdgatlrr
sielatyiavndyeaklvcdktgwsedeiasrvqaliitrgehgatirhrdgteqipavr
aervidptgcgdafrggllygiehgfdwatagrlaslmgalkiahqgpqtyaptraeida
rfetafgyrp

SCOPe Domain Coordinates for d3b1rf_:

Click to download the PDB-style file with coordinates for d3b1rf_.
(The format of our PDB-style files is described here.)

Timeline for d3b1rf_: