Lineage for d1mfeh1 (1mfe H:251-367)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2352461Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2352672Protein Immunoglobulin heavy chain variable domain, VH [88543] (22 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 2353188Species Mouse (Mus musculus), cluster 3.2 [TaxId:10090] [88552] (184 PDB entries)
    Uniprot P01756 1-117 # 78% sequense identity; HV12_MOUSE Ig heavy chain V region MOPC 104E ! SQ NA # humanized antibody ! Uniprot P01750 # HV06_MOUSE Ig heavy chain V region 102 precursor ! Uniprot P01750 20-116 # ! HV06_MOUSE Ig heavy chain V region 102 precursor
  8. 2353231Domain d1mfeh1: 1mfe H:251-367 [19893]
    Other proteins in same PDB: d1mfeh2, d1mfel1, d1mfel2
    part of Fab SE155-4

Details for d1mfeh1

PDB Entry: 1mfe (more details), 2 Å

PDB Description: recognition of a cell-surface oligo-saccharide of pathogenic salmonella by an antibody fab fragment
PDB Compounds: (H:) igg1-lambda se155-4 fab (heavy chain)

SCOPe Domain Sequences for d1mfeh1:

Sequence, based on SEQRES records: (download)

>d1mfeh1 b.1.1.1 (H:251-367) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]}
evqvqqsgtvlarpgasvkmsckasgytftnywmhwikqrpgqglewigaiypgnsatfy
nhkfraktkltavtstitaymelssltnedsavyyctrgghgyygdywgqgasltvs

Sequence, based on observed residues (ATOM records): (download)

>d1mfeh1 b.1.1.1 (H:251-367) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]}
evqvqqsgtvlarpgasvkmsckasgytftnywmhwikqrpgglewigaiypgnsatfyn
hkfraktkltavtstitaymelssltnedsavyyctrgghgyygdywgqgasltvs

SCOPe Domain Coordinates for d1mfeh1:

Click to download the PDB-style file with coordinates for d1mfeh1.
(The format of our PDB-style files is described here.)

Timeline for d1mfeh1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1mfeh2