SCOPe 2.07: Domain d1mfel1: 1mfe L:1-111

Lineage for d1mfel1 (1mfe L:1-111)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein Immunoglobulin light chain lambda variable domain, VL-lambda [88534] (9 species)
   VL-lambda domains of human antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the human genome; mouse VL-lambda domains belong to a single germline family

7. Species Mouse (Mus musculus) [TaxId:10090] [88541] (36 PDB entries)

8. Domain d1mfel1: 1mfe L:1-111 [19892]
   Other proteins in same PDB: d1mfeh1, d1mfeh2, d1mfel2
   part of Fab SE155-4

Details for d1mfel1

PDB Entry: 1mfe, 2 Å

PDB Description: recognition of a cell-surface oligo-saccharide of pathogenic salmonella by an antibody fab fragment

PDB Compounds: (L:) igg1-lambda se155-4 fab (light chain)

SCOPe Domain Sequences for d1mfel1:

Sequence; same for both SEQRES and ATOM records:

>d1mfel1 b.1.1.1 (L:1-111) Immunoglobulin light chain lambda variable domain, VL-lambda {Mouse (Mus musculus) [TaxId: 10090]}
eavvtqesalttspgetvtltcrsstgtvtsgnhanwvqekpdhlftgligdtnnrapgv
parfsgsligdkaaltitgaqpedeaiyfcalwcnnhwifgggtkltvlgq

Timeline for d1mfel1:

• d1mfel1 first appeared (with stable ids) in SCOP 1.55
  
• d1mfel1 appears in SCOPe 2.06
  
• d1mfel1 appears in the current release, SCOPe 2.08