SCOPe 2.05: Domain d2y8le2: 2y8l E:182-327

Lineage for d2y8le2 (2y8l E:182-327)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.37: CBS-domain pair [54630] (1 superfamily)
   duplication: tandem repeat of two beta-X-beta-alpha-beta(2)-alpha motifs of similar sequences; 4 layers: a/b/b/a

4. Superfamily d.37.1: CBS-domain pair [54631] (2 families)

5. Family d.37.1.1: CBS-domain pair [54632] (21 proteins)
   Pfam PF00571; pairs of CBS domains dimerize to form a stable globular domain, a.k.a. Bateman domain

6. Protein 5'-AMP-activated protein kinase subunit gamma-1, AMPKg [160176] (1 species)

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [160177] (7 PDB entries)
   Uniprot P80385 182-326! Uniprot P80385 23-181

8. Domain d2y8le2: 2y8l E:182-327 [198690]
   Other proteins in same PDB: d2y8la_, d2y8lb_
   automated match to d2v8qe1
   complexed with adp, amp

Details for d2y8le2

PDB Entry: 2y8l, 2.5 Å

PDB Description: Structure of an active form of mammalian AMPK in complex with two ADP

PDB Compounds: (E:) 5'-amp-activated protein kinase subunit gamma-1

SCOPe Domain Sequences for d2y8le2:

Sequence; same for both SEQRES and ATOM records:

>d2y8le2 d.37.1.1 (E:182-327) 5'-AMP-activated protein kinase subunit gamma-1, AMPKg {Norway rat (Rattus norvegicus) [TaxId: 10116]}
fpkpefmsksleelqigtyaniamvrtttpvyvalgifvqhrvsalpvvdekgrvvdiys
kfdvinlaaektynnldvsvtkalqhrshyfegvlkcylhetleaiinrlveaevhrlvv
vdehdvvkgivslsdilqalvltgge

Timeline for d2y8le2:

• d2y8le2 first appeared in SCOPe 2.03
  
• d2y8le2 appears in SCOPe 2.04
  
• d2y8le2 appears in SCOPe 2.06
  
• d2y8le2 appears in the current release, SCOPe 2.08