Lineage for d2wpad2 (2wpa D:310-432)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2718075Fold a.74: Cyclin-like [47953] (1 superfamily)
    core: 5 helices; one helix is surrounded by the others
  4. 2718076Superfamily a.74.1: Cyclin-like [47954] (4 families) (S)
    duplication: consists of two domains of this fold
  5. 2718077Family a.74.1.1: Cyclin [47955] (9 proteins)
  6. 2718090Protein Cyclin A [47956] (2 species)
  7. 2718126Species Human (Homo sapiens) [TaxId:9606] [47957] (89 PDB entries)
    Uniprot P20248 175-432
  8. 2718364Domain d2wpad2: 2wpa D:310-432 [198540]
    Other proteins in same PDB: d2wpaa1, d2wpaa2, d2wpac1, d2wpac2
    automated match to d1vywb2
    complexed with 889, so4

Details for d2wpad2

PDB Entry: 2wpa (more details), 2.51 Å

PDB Description: optimisation of 6,6-dimethyl pyrrolo 3,4-c pyrazoles: identification of pha-793887, a potent cdk inhibitor suitable for intravenous dosing
PDB Compounds: (D:) cyclin a2

SCOPe Domain Sequences for d2wpad2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2wpad2 a.74.1.1 (D:310-432) Cyclin A {Human (Homo sapiens) [TaxId: 9606]}
tvnqfltqyflhqqpanckveslamflgelslidadpylkylpsviagaafhlalytvtg
qswpeslirktgytleslkpclmdlhqtylkapqhaqqsirekyknskyhgvsllnppet
lnl

SCOPe Domain Coordinates for d2wpad2:

Click to download the PDB-style file with coordinates for d2wpad2.
(The format of our PDB-style files is described here.)

Timeline for d2wpad2: