SCOPe 2.08: Domain d2wpab2: 2wpa B:310-432

Lineage for d2wpab2 (2wpa B:310-432)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.74: Cyclin-like [47953] (1 superfamily)
   core: 5 helices; one helix is surrounded by the others

4. Superfamily a.74.1: Cyclin-like [47954] (4 families)
   duplication: consists of two domains of this fold

5. Family a.74.1.1: Cyclin [47955] (9 proteins)

6. Protein Cyclin A [47956] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [47957] (89 PDB entries)
   Uniprot P20248 175-432

8. Domain d2wpab2: 2wpa B:310-432 [198538]
   Other proteins in same PDB: d2wpaa1, d2wpaa2, d2wpac1, d2wpac2
   automated match to d1vywb2
   complexed with 889, so4

Details for d2wpab2

PDB Entry: 2wpa, 2.51 Å

PDB Description: optimisation of 6,6-dimethyl pyrrolo 3,4-c pyrazoles: identification of pha-793887, a potent cdk inhibitor suitable for intravenous dosing

PDB Compounds: (B:) cyclin a2

SCOPe Domain Sequences for d2wpab2:

Sequence; same for both SEQRES and ATOM records:

>d2wpab2 a.74.1.1 (B:310-432) Cyclin A {Human (Homo sapiens) [TaxId: 9606]}
tvnqfltqyflhqqpanckveslamflgelslidadpylkylpsviagaafhlalytvtg
qswpeslirktgytleslkpclmdlhqtylkapqhaqqsirekyknskyhgvsllnppet
lnl

Timeline for d2wpab2:

• d2wpab2 first appeared in SCOPe 2.03
  
• d2wpab2 appears in SCOPe 2.07