SCOPe 2.08: Domain d2wdqf1: 2wdq F:1-106

Lineage for d2wdqf1 (2wdq F:1-106)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families)

5. Family d.15.4.2: 2Fe-2S ferredoxin domains from multidomain proteins [54312] (14 proteins)

6. Protein Succinate dehydogenase iron-sulfur protein, N-terminal domain [82586] (3 species)

7. Species Escherichia coli [TaxId:562] [82587] (6 PDB entries)

8. Domain d2wdqf1: 2wdq F:1-106 [198482]
   Other proteins in same PDB: d2wdqa1, d2wdqa2, d2wdqa3, d2wdqb2, d2wdqc_, d2wdqd_, d2wdqe1, d2wdqe2, d2wdqe3, d2wdqf2, d2wdqg_, d2wdqh_, d2wdqi1, d2wdqi2, d2wdqi3, d2wdqj2, d2wdqk_, d2wdql_
   automated match to d1nekb2
   complexed with cbe, f3s, fad, fes, hem, na, sf4, so4, teo

Details for d2wdqf1

PDB Entry: 2wdq, 2.4 Å

PDB Description: e. coli succinate:quinone oxidoreductase (sqr) with carboxin bound

PDB Compounds: (F:) succinate dehydrogenase iron-sulfur subunit

SCOPe Domain Sequences for d2wdqf1:

Sequence; same for both SEQRES and ATOM records:

>d2wdqf1 d.15.4.2 (F:1-106) Succinate dehydogenase iron-sulfur protein, N-terminal domain {Escherichia coli [TaxId: 562]}
mrlefsiyrynpdvddaprmqdytleadegrdmmlldaliqlkekdpslsfrrscregvc
gsdglnmngknglacitpisalnqpgkkivirplpglpvirdlvvd

Timeline for d2wdqf1:

• d2wdqf1 first appeared in SCOPe 2.03
  
• d2wdqf1 appears in SCOPe 2.07