SCOPe 2.08: Domain d2j8dh1: 2j8d H:1-35

Lineage for d2j8dh1 (2j8d H:1-35)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
   not a true fold
   annotated by the SCOP(e) curators as 'not a true fold'

4. Superfamily f.23.10: Photosystem II reaction centre subunit H, transmembrane region [81490] (2 families)

5. Family f.23.10.1: Photosystem II reaction centre subunit H, transmembrane region [81489] (1 protein)

6. Protein Photosystem II reaction centre subunit H, transmembrane region [81488] (4 species)

7. Species Rhodobacter sphaeroides [TaxId:1063] [81486] (88 PDB entries)
   Uniprot P11846

8. Domain d2j8dh1: 2j8d H:1-35 [198094]
   Other proteins in same PDB: d2j8dh2, d2j8dl_, d2j8dm_
   automated match to d1ysth2
   complexed with bcl, bph, cdl, fe, gol, hto, lda, po4, spo, u10

Details for d2j8dh1

PDB Entry: 2j8d, 2.07 Å

PDB Description: x-ray high resolution structure of the photosynthetic reaction center from rb. sphaeroides at ph 8 in the charge-separated state

PDB Compounds: (H:) reaction center protein h chain

SCOPe Domain Sequences for d2j8dh1:

Sequence; same for both SEQRES and ATOM records:

>d2j8dh1 f.23.10.1 (H:1-35) Photosystem II reaction centre subunit H, transmembrane region {Rhodobacter sphaeroides [TaxId: 1063]}
mvgvtafgnfdlaslaiysfwiflagliyylqten

Timeline for d2j8dh1:

• d2j8dh1 first appeared in SCOPe 2.03
  
• d2j8dh1 appears in SCOPe 2.07