Class f: Membrane and cell surface proteins and peptides [56835] (57 folds) |
Fold f.23: Single transmembrane helix [81407] (38 superfamilies) not a true fold |
Superfamily f.23.10: Photosystem II reaction centre subunit H, transmembrane region [81490] (2 families) |
Family f.23.10.1: Photosystem II reaction centre subunit H, transmembrane region [81489] (1 protein) |
Protein Photosystem II reaction centre subunit H, transmembrane region [81488] (3 species) |
Species Rhodobacter sphaeroides [TaxId:1063] [81486] (78 PDB entries) Uniprot P11846 |
Domain d2j8dh1: 2j8d H:1-35 [198094] Other proteins in same PDB: d2j8dh2, d2j8dl_, d2j8dm_ automated match to d1ysth2 complexed with bcl, bph, cdl, fe, gol, hto, lda, po4, spo, u10 |
PDB Entry: 2j8d (more details), 2.07 Å
SCOPe Domain Sequences for d2j8dh1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2j8dh1 f.23.10.1 (H:1-35) Photosystem II reaction centre subunit H, transmembrane region {Rhodobacter sphaeroides [TaxId: 1063]} mvgvtafgnfdlaslaiysfwiflagliyylqten
Timeline for d2j8dh1: