Lineage for d7fabl1 (7fab L:1-103)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 929299Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 929300Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 929301Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 931241Protein Immunoglobulin light chain lambda variable domain, VL-lambda [88534] (9 species)
    VL-lambda domains of human antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the human genome; mouse VL-lambda domains belong to a single germline family
  7. 931274Species Human (Homo sapiens), cluster 3.2 [TaxId:9606] [88538] (1 PDB entry)
  8. 931275Domain d7fabl1: 7fab L:1-103 [19776]
    Other proteins in same PDB: d7fabh1, d7fabh2, d7fabl2
    part of Fab NEW

Details for d7fabl1

PDB Entry: 7fab (more details), 2 Å

PDB Description: crystal structure of human immunoglobulin fragment fab new refined at 2.0 angstroms resolution
PDB Compounds: (L:) igg1-lambda new fab (light chain)

SCOPe Domain Sequences for d7fabl1:

Sequence; same for both SEQRES and ATOM records: (download)

>d7fabl1 b.1.1.1 (L:1-103) Immunoglobulin light chain lambda variable domain, VL-lambda {Human (Homo sapiens), cluster 3.2 [TaxId: 9606]}
asvltqppsvsgapgqrvtisctgsssnigaghnvkwyqqlpgtapkllifhnnarfsvs
ksgtsatlaitglqaedeadyycqsydrslrvfgggtkltvlr

SCOPe Domain Coordinates for d7fabl1:

Click to download the PDB-style file with coordinates for d7fabl1.
(The format of our PDB-style files is described here.)

Timeline for d7fabl1:

View in 3D
Domains from same chain:
(mouse over for more information)
d7fabl2