SCOP 1.71: Domain d1gya__: 1gya -

Lineage for d1gya__ (1gya -)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (28 proteins)

6. Protein CD2, first domain [48740] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [48741] (4 PDB entries)

8. Domain d1gya__: 1gya - [19745]
   complexed with man, nag

Details for d1gya__

PDB Entry: 1gya

PDB Description: n-glycan and polypeptide nmr solution structures of the adhesion domain of human cd2

SCOP Domain Sequences for d1gya__:

Sequence; same for both SEQRES and ATOM records:

>d1gya__ b.1.1.1 (-) CD2, first domain {Human (Homo sapiens)}
keitnaletwgalgqdinldipsfqmsddiddikwektsdkkkiaqfrkeketfkekdty
klfkngtlkikhlktddqdiykvsiydtkgknvlekifdlkiqer

Timeline for d1gya__:

• d1gya__ first appeared (with stable ids) in SCOP 1.55
  
• d1gya__ appears in SCOP 1.69
  
• d1gya__ is called d1gyaa_ in SCOP 1.73
  
• d1gya__ appears in the current release, SCOPe 2.08, called d1gyaa_